NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209086_10016743

Scaffold Ga0209086_10016743


Overview

Basic Information
Taxon OID3300027770 Open in IMG/M
Scaffold IDGa0209086_10016743 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4727
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015591Metagenome / Metatranscriptome253N
F048951Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0209086_1001674311F015591N/AVPASRNAHYQPNRYAEISQTTSMSEYEDPIAEFIEASAEGLCTAYIVIANIERINGDQSFWVTTLRNQTASTSLGLLESASAAEKYRIARSFNHHPDDDE
Ga0209086_1001674312F048951AGGAGGMTNKRMNKGYNYPASALLKEFADDTWASTIAEHLGVGRAAIQTWREGNTYLDQWRADKYACALGKHPSEIWLNWFDEVELAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.