Basic Information | |
---|---|
Taxon OID | 3300027768 Open in IMG/M |
Scaffold ID | Ga0209772_10254686 Open in IMG/M |
Source Dataset Name | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 557 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Calvert Island, British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058503 | Metagenome / Metatranscriptome | 135 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209772_102546861 | F058503 | GAGG | MTENGFGQPLPPSSAIQAERGEITARESLGQATPFQEQLDNVRSWRERLSPKFRRACSAGQLLLQVVGAAGYAGYFVSMHTFMRVLSGALMAGTWYVIYRIKGAAHP |
⦗Top⦘ |