NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209296_1026465

Scaffold Ga0209296_1026465


Overview

Basic Information
Taxon OID3300027759 Open in IMG/M
Scaffold IDGa0209296_1026465 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3240
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032271Metagenome180Y
F104514Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0209296_10264655F032271GAGMVRIHDLSTNTITDREMTDEEFAQYEADQAEMAARIAAKAAEAIAKAALLTQLGITEEQAKLLLS
Ga0209296_10264657F104514AGGMIKENETVSVGWCDNGMVDGKFTEGIVSIVLGGVNNGMPIASSIRVQGNQIARQRQSLLDHWYDKTKTDWLLWVDSDVVVDMNIWKLLHDTADKDTHPMVSGIYFIGKDKDGSIPVFMPVIFDDIDEYTVKYHHPLPPNQVLKIDMAGMGFVVMHRDVVTKLREKYGNEVSFFAENDQKNDKFVGEDISFFRKCKATGIPLHAHTGAIAKHMKTTVWDMDLYALFWSMQHIKDQLKAKQTQGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.