Scaffold Ga0209192_10130227

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209192_10130227

Scaffold Ga0209192_10130227

Overview

Basic Information
Taxon OID	3300027752 Open in IMG/M
Scaffold ID	Ga0209192_10130227 Open in IMG/M
Source Dataset Name	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1011
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location Name	Arctic Ocean: Canada Basin
Coordinates	Lat. (^o)	73.2247	Long. (^o)	-150.2247	Alt. (m)		Depth (m)	7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068132	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209192_101302274	F068132	GAGG	LENSKPIFASQDTTLIKKCVQYYIQNGPFLSESEKNTYTALFHRMGRMGNQSNILREPMENPDAPHLRETLFDDAGG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.