Scaffold Ga0209084_1007870

Overview

Basic Information

• Taxon OID: 3300027749
• Scaffold ID: Ga0209084_1007870
• Source Dataset Name: Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6806
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (55.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Croche, Canada
• Coordinates
  • Lat. (^o): 46.8319
  • Long. (^o): -72.5
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066584	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209084_100787017	F066584	N/A	MKHRNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLTIGK