NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209908_10003799

Scaffold Ga0209908_10003799


Overview

Basic Information
Taxon OID3300027745 Open in IMG/M
Scaffold IDGa0209908_10003799 Open in IMG/M
Source Dataset NameThawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2116
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location NameSweden: Kiruna
CoordinatesLat. (o)68.3534Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002101Metagenome / Metatranscriptome593Y
F003337Metagenome / Metatranscriptome493Y
F004095Metagenome / Metatranscriptome453Y

Sequences

Protein IDFamilyRBSSequence
Ga0209908_100037991F003337N/ADEMCIRDSNGGVWVNGTEVADSTTVFPGDVLETKPGFVANLDAEGSSVLIQGESIVKFQGNSLTLEHGKVSVGTSTAMNVNVNCLKVEPISNERTQYDVTDVSGKVEVAANKNDVKITLTGALRKASSESGSSDSATVHEGQRATRDESTACGVAPRPGGASTTPLNTKWLEIGGGAGAGVLVLCLLLCKGSGPSNVSPSQP
Ga0209908_100037992F004095AGGAGMSAINGDKARFNRRRRQKISRRQSNEKMLKALAEKHLVAPAAPANLKEKMA
Ga0209908_100037993F002101AGGAGMTMPVLSLPLPSPDGSPVKKKRVLLLDTSQTKRDLRADVMRKLGIEVDCAADVLEARCWWRADLYNLVLISVAGEADSRDKFCTDMRSASPPQRIAFFVGGPEYLAAAPHSDAGPAEADADALHKEMVAALLAQAASDSSHQRWGILEACKRISSVRSVSEARSRAVRETPRPSRWEEAIERYSAPEAINPQPLFTTASAPPLSTAETEREELL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.