NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209908_10002311

Scaffold Ga0209908_10002311


Overview

Basic Information
Taxon OID3300027745 Open in IMG/M
Scaffold IDGa0209908_10002311 Open in IMG/M
Source Dataset NameThawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2445
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location NameSweden: Kiruna
CoordinatesLat. (o)68.3534Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009971Metagenome / Metatranscriptome310Y
F054196Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0209908_100023111F009971GGAGVRKSFWGILLLFLPMASALAQAPALQMNVVYVCTDGQSFKVFSCDNTTGACDYQNYKKGQAFQRGEALRVQLAALLPAKCHAQTPAEAQADPHHGEIPPAPSPFKAHAAAGSNGVGATPANQSGPGGFKVGDTVRVLIDGWQEAKVIEVHGRSYLVHLPNGINVSKLWPYEVHRVGKLTAEDHAAGQYDLHDRVQVLVNGKWMEGEIRGQNNVNMYDIKVPGVDTGFGSDIVNTTPENIRISTTPAPLPPAQRAAGQAPKPGLVSCAGKYEGRWEHVSGMEGMKVVFRSGKATITEGLGGEMPFDCFTGDGKVVFYKAGSFTPFSYDFDINLDGTLQTPLGAIKKMGN
Ga0209908_100023112F054196AGGAGGMRGQMPVALFALVFGVLEFAGGAQEMVYLGFLQSERYPLIAGALGVLAGALLLAAGVALLVRSPLASVLAQAAAWVSVPVFILTGVITHRAGWPITAVGIGYPLLLTFFCLRGEKRGNAMSKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.