Scaffold Ga0209121_10119289

Overview

Basic Information

• Taxon OID: 3300027742
• Scaffold ID: Ga0209121_10119289
• Source Dataset Name: Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1074
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location

• Location Name: Coal Oil Point, Santa Barbara, CA
• Coordinates
  • Lat. (^o): 34.39225
  • Long. (^o): -119.845662
  • Depth (m): 47

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065254	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209121_101192893	F065254	N/A	PVALNKGSEQTEKVSVVTETVLWGCPGTYFKATLPFNRMMQFFAAFKKRPRGPAR