NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209121_10102012

Scaffold Ga0209121_10102012


Overview

Basic Information
Taxon OID3300027742 Open in IMG/M
Scaffold IDGa0209121_10102012 Open in IMG/M
Source Dataset NameOil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1216
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location NameCoal Oil Point, Santa Barbara, CA
CoordinatesLat. (o)34.39225Long. (o)-119.845662Alt. (m)Depth (m)47
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020112Metagenome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0209121_101020123F020112AGGAGGLVSKALKKCVELVEEMLREGYRLQISSTHVDRLIKIHVGADKRTVQKYMRLLTEDFGFLQTVTKNPFGVCIYRIDIETIEQYVSEHMKERLRQLTLLDLRLREEEAG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.