Scaffold Ga0209121_10018254

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209121_10018254

Scaffold Ga0209121_10018254

Overview

Basic Information
Taxon OID	3300027742 Open in IMG/M
Scaffold ID	Ga0209121_10018254 Open in IMG/M
Source Dataset Name	Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4771
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location Name	Coal Oil Point, Santa Barbara, CA
Coordinates	Lat. (^o)	34.39225	Long. (^o)	-119.845662	Alt. (m)		Depth (m)	47
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047488	Metagenome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209121_100182543	F047488	GGA	LLDLILDSDINPLLLSSFVGALQLFGAENMGKIEEIRIKGLSIDMIIVNKYNLVMITILDKAFVKDGIRGESEKALDMFYTIYRDEIEDCDEVYQFKSFKKILYDQIEDYFIRIKNEDSRAKIGDFGFFTGAIAKLRNGSH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.