NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214474_1141973

Scaffold Ga0214474_1141973


Overview

Basic Information
Taxon OID3300027740 Open in IMG/M
Scaffold IDGa0214474_1141973 Open in IMG/M
Source Dataset NameSoil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)894
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)42.9888Long. (o)-108.3994Alt. (m)Depth (m)214
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050466Metagenome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0214474_11419731F050466GGAMAEESERLIRPIRNASAPGTLAALCLAALRVSGDLPHALKYGLLAGAIMFLLSAFFVFFYSIYPTRKKFWTVTAVTFLFGLLSLVSSAVAMLFTV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.