NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209190_1071872

Scaffold Ga0209190_1071872


Overview

Basic Information
Taxon OID3300027736 Open in IMG/M
Scaffold IDGa0209190_1071872 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1669
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016365Metagenome / Metatranscriptome247Y
F049582Metagenome / Metatranscriptome146Y
F068762Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0209190_10718722F049582AGGAGMAHKDIHTVLATRFRNESDLTISMMKRAISDLGIVNPEALDIIYESVMFYTGDWPETQGWGSSDSRICVNSVKETLLACEYLVTVA
Ga0209190_10718725F016365GGAGGMHNNQRKTMNATQKLILATAAVIYGMTAPLPANETIKETQDAINKWYETVSTSVSQDVTALGVTVVNLPNNIALGVSSFWEETKQFQKDSWNETLKFEQEKQNWATIKGWFTPATEEVKK
Ga0209190_10718726F068762GAGGMLRQQDLYHLYAGIRERLHEIMIERHPDPIQSQVRRELAEELLEYLHNNEEGLKTMHNYKEQWTRGENE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.