NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209297_1005071

Scaffold Ga0209297_1005071


Overview

Basic Information
Taxon OID3300027733 Open in IMG/M
Scaffold IDGa0209297_1005071 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6820
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (76.19%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006885Metagenome / Metatranscriptome362Y
F018928Metagenome / Metatranscriptome232Y
F045545Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
Ga0209297_10050714F045545GAGGMIKQIGMFFICKIKSHNFVDAGSCPFTGKSYLACLRCERTLSK
Ga0209297_10050717F018928AGGAGMIIRSLNTMDKIINKNKNLFWDGWDVIDLKESDIAKTSVNGIRVKNKWYLHKIYKPGRNGWDIPNKYKE
Ga0209297_10050719F006885N/AMEYLLIVGLTFVASWSIIKISNKKRRRFLSKIRYRQSNIYEIVKDVIPKEMFEKPKVMTQSQKHVQKNMLKVVITEGKAYWILDNVFYIADSINGRVDESTVEPLDIQNLSKKDLNKMLSILDDLRKGMESNDSGSSGNNSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.