NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209442_1139324

Scaffold Ga0209442_1139324


Overview

Basic Information
Taxon OID3300027732 Open in IMG/M
Scaffold IDGa0209442_1139324 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)943
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000354Metagenome / Metatranscriptome1244Y
F045555Metagenome / Metatranscriptome152Y
F049484Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0209442_11393241F000354N/AKLNYDKFASFDLNEACDHFDCTDQRAWKKIRPFIVADGEEYMEVMEKEFDFEDTADSEYEAFQAGVKYALTKMNVAFEKAGVDLQVCEVDLVESYGYMLVRCDDEPEDFVKRVMKKPVMMVDSWI
Ga0209442_11393242F045555AGGAGMTSIFIVRAEDRGAPESIIYGVYPTAKLAEARIAVLEGEDFEHDFAWFDEVKVGPMGADCEFANR
Ga0209442_11393243F049484GGAGMITAQQIRQGKILAVNAAQAMYQKIGERDACGFGWVEVYVDRTNSKQAKELIAAGFRKDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.