Scaffold Ga0247833_1149764

Overview

Basic Information

• Taxon OID: 3300027730
• Scaffold ID: Ga0247833_1149764
• Source Dataset Name: Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 937
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Spain: Castile-La Mancha
• Coordinates
  • Lat. (^o): 39.9879
  • Long. (^o): -1.8737
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034149	Metagenome / Metatranscriptome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247833_11497641	F034149	AGG	MSISQGLVMDANEEPGFEILHLSFRKQESEAFSGVPINFYHGNIVFRLTNEDAINGMKYYMEENEKLRVAPDEELLNKYYEDLHFDIGSDNEDEGVVDEEDGQKYYPVNIINKNGIKDEDVFIYAYRRNMMPLHDFIQYHEKFDVYSMREYFQD