Scaffold Ga0209819_10322084

Overview

Basic Information

• Taxon OID: 3300027722
• Scaffold ID: Ga0209819_10322084
• Source Dataset Name: Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 530
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location

• Location Name: near Jamestown, North Dakota
• Coordinates
  • Lat. (^o): 47.0956
  • Long. (^o): -99.1001
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077982	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209819_103220842	F077982	N/A	YAPRTDVVSPLMKQAPAKMKVVPLPMTLATRYNEYFQTYRKVMGLK