Scaffold Ga0209617_10001633

Overview

Basic Information

• Taxon OID: 3300027720
• Scaffold ID: Ga0209617_10001633
• Source Dataset Name: Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10490
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (10.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Lake Erie, Canada
• Coordinates
  • Lat. (^o): 41.77
  • Long. (^o): -81.73
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032631	Metagenome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209617_100016335	F032631	AGTAG	MEDDPDMKWYDNIFIIDLLIFIFSFAFLGIAGLVMYICYPPVLMAFQT