NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209617_10000116

Scaffold Ga0209617_10000116


Overview

Basic Information
Taxon OID3300027720 Open in IMG/M
Scaffold IDGa0209617_10000116 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30454
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (41.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010817Metagenome / Metatranscriptome298Y
F024058Metagenome / Metatranscriptome207N
F028084Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
Ga0209617_1000011611F024058N/AMTHRMINWNFQRKQMRENMRKNMDSSESIITNSDNTPTYFGQIYLYEGTLVKVSYKTSANTAVVTFLEGKDKDKVGTINLNNAKLVKENK
Ga0209617_1000011634F010817AGGALNKLASILVLNFLFVGCATVTPNKIQDDKSSYDATTPKQYDKDNGGLISFVGDDALITRQARERYNNLIKMYRIKFKKEKAIDLTEDSGITPYKDNFGNELFLISSEHLVYFGVLNSWLKEKVPADNILDKTIDKINN
Ga0209617_1000011636F028084N/AVKKLILILPLFLLISCSEPNYESRELPTKYPETPTMGSADDVTKELYKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.