Scaffold Ga0208665_10075342

Overview

Basic Information

• Taxon OID: 3300027715
• Scaffold ID: Ga0208665_10075342
• Source Dataset Name: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1016
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 41.3769
  • Long. (^o): -82.5172

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010327	Metagenome / Metatranscriptome	305	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208665_100753422	F010327	AGG	MDANANGWIGAPIKAPDEARTGRLREEGNAEWRPKPPVPFGLRPKTPGAALRSLAGCPTRLRLRALRGAFSA