Scaffold Ga0209599_10060370

Overview

Basic Information

• Taxon OID: 3300027710
• Scaffold ID: Ga0209599_10060370
• Source Dataset Name: Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 997
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: Ohio, USA
• Coordinates
  • Lat. (^o): 39.849
  • Long. (^o): -81.036
  • Depth (m): 2500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017297	Metagenome	241	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209599_100603702	F017297	N/A	VQQIGVNIMKITEQKNGNYTTFERIAYNGYYIVKLYKRGELADKIMADTYKGAREYLKSFNLLAKNS