Scaffold Ga0209752_1185594

Overview

Basic Information

• Taxon OID: 3300027699
• Scaffold ID: Ga0209752_1185594
• Source Dataset Name: Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_250m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 581
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon SCGC AC-337_F14 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 8.0
  • Long. (^o): -156.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060045	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209752_11855941	F060045	N/A	YSKDIRVQASVSIWKNLVFVFVNATWVVPLVVLAAKKTTMMHTNVSAVKYILSR