Scaffold Ga0209554_1072822

Overview

Basic Information

• Taxon OID: 3300027685
• Scaffold ID: Ga0209554_1072822
• Source Dataset Name: Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1184
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -37.9728
  • Long. (^o): -44.9905
  • Depth (m): 5110

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002187	Metagenome / Metatranscriptome	585	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209554_10728223	F002187	N/A	MKFKNRVFLNEKFMQTVAKCNEYEDWEPKGAYWFNRLVKKLRSAQEDFSDTRNKLVKKYGDEPDKDGNVKVAEVHIPAFSTAMGELMEEEFEIEGIKPIKFPEGLKLSPSEMGHMEEVVDMSAFLDDDDEDE