NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209118_1000841

Scaffold Ga0209118_1000841


Overview

Basic Information
Taxon OID3300027674 Open in IMG/M
Scaffold IDGa0209118_1000841 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15361
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (84.21%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003165Metagenome / Metatranscriptome504Y
F046588Metagenome / Metatranscriptome151Y
F105941Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0209118_100084111F046588GAGMTFIPTQTGFMRLEDSEKLLRAIFPNYPSLEPCVSAPPLEPIPQGSKEYLNEERMSLC
Ga0209118_100084112F003165AGGAGMAKVIEFYIPTNFRKPLRTSPQPQLGKIIEFCSQTKRSA
Ga0209118_100084113F105941GGAMWKVTTRGFTLHEVLIMAATNVASALIATAKSERTTGTAPSTEIQQAPGEMSWQR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.