Scaffold Ga0209383_1086152

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209383_1086152

Scaffold Ga0209383_1086152

Overview

Basic Information
Taxon OID	3300027672 Open in IMG/M
Scaffold ID	Ga0209383_1086152 Open in IMG/M
Source Dataset Name	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1078
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location Name	Atlantic Ocean: West Antarctic Peninsula
Coordinates	Lat. (^o)	-64.8156	Long. (^o)	-64.0406	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059054	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209383_10861521	F059054	N/A	FPVFEFLSFENNKNKAPIVGKRIKDDKIGKFINIKLKKLIMQKDLSIS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.