Scaffold Ga0209388_1167418

Overview

Basic Information

• Taxon OID: 3300027655
• Scaffold ID: Ga0209388_1167418
• Source Dataset Name: Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 617
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: Eel River Critical Zone Observatory, California, USA
• Coordinates
  • Lat. (^o): 39.7291
  • Long. (^o): -123.6419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053488	Metagenome / Metatranscriptome	141	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209388_11674182	F053488	N/A	MNPNAAKNFIVRNAFICAAAIAITSCATLTKPESDVSFENLRAFEISFVDQYAVPGKRFDATAFDAKVAEGNAKFQDAMTNEKFKARRPVLKDLADQFKAEAAHLRKKASTGKITKALAAEMKRDIND