Scaffold Ga0209487_1000015

Overview

Basic Information

• Taxon OID: 3300027653
• Scaffold ID: Ga0209487_1000015
• Source Dataset Name: Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2012 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 203625
• Total Scaffold Genes: 169
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 145 (85.80%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.8834
  • Long. (^o): -83.4195

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209487_100001519	F036417	N/A	MAVYTRLTLRSLIPTVIVRLITDDGEITFRARWKDSALDLQRNILFRLRQGSPLIFEDEWGRTISFPAERISGAMVDGR