Scaffold Ga0209339_1047785

Overview

Basic Information

• Taxon OID: 3300027632
• Scaffold ID: Ga0209339_1047785
• Source Dataset Name: Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3079
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Zanca-sant'andrea, Tuscany, Italy
• Coordinates
  • Lat. (^o): 42.8072
  • Long. (^o): 10.1411
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075403	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209339_10477852	F075403	N/A	RHSAPPRDVFLTAGARAYQKHVLHGPETVSIFVLTQPQIKYPWIGWTEPHGYISFDRAESRLLRECHPIAKAAYMVVKRMSKYFCQHAFFSSHTIKMALLWCLDKKDLMKYRSFYGSDEVNGCELLCLVQKFLRKLLCFAAQDYVPSYFMPSCHQPVWLSERYLKQYHIRLYQHGLTYKDLFSLSEQQSHDRDLQSIKTLFTFSHVMYWTVLSEADELKLFVPSTMNPLYENSYDSDEQICS