Basic Information | |
---|---|
Taxon OID | 3300027631 Open in IMG/M |
Scaffold ID | Ga0208133_1000201 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 24292 |
Total Scaffold Genes | 36 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (22.22%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Columbia River Estuary | |||||||
Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010620 | Metagenome | 301 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208133_100020132 | F010620 | GAG | MPTNDNNVRELMRHLLSILILSLLFSCSDAKKAQYHYKKALKYGLELVQDSDTIRIISVDSIPVVVNDTIIWEKIITTKDTIINFKNVYVPKTRWQTKIEYRYKTQILKQDVLKYKYIYKTEKKQKAKTNWMLLVWGFIIGVLLSFVTRLLLKLYLPF |
⦗Top⦘ |