Basic Information | |
---|---|
Taxon OID | 3300027630 Open in IMG/M |
Scaffold ID | Ga0209432_1024109 Open in IMG/M |
Source Dataset Name | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1709 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 8.0 | Long. (o) | -156.0 | Alt. (m) | Depth (m) | 800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060831 | Metagenome / Metatranscriptome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209432_10241091 | F060831 | N/A | MLKIKINTDNQAFDQEGQEVARILRDLANQVAHLDKLQECQLPLRDLNGNTVGYYQTWTDQGESQGAVISSPYATWTQNQFPN |
⦗Top⦘ |