Scaffold Ga0209828_1073480

Overview

Basic Information

• Taxon OID: 3300027623
• Scaffold ID: Ga0209828_1073480
• Source Dataset Name: Marine algal microbial communities from Maine, USA - Maine_Asex2 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1189
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location

• Location Name: Maine, USA
• Coordinates
  • Lat. (^o): 44.342
  • Long. (^o): -68.065
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045507	Metagenome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209828_10734802	F045507	GGAGG	MGGIKIDKLTETNFHEWRQRIKMVLALRDLDDMLDEDRKPTDAETRELAL