Scaffold Ga0208736_1043220

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208736_1043220

Scaffold Ga0208736_1043220

Overview

Basic Information
Taxon OID	3300027618 Open in IMG/M
Scaffold ID	Ga0208736_1043220 Open in IMG/M
Source Dataset Name	Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1126
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location Name	Antarctic Dry Valleys
Coordinates	Lat. (^o)	-78.0486	Long. (^o)	163.8053	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093466	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208736_10432202	F093466	AGGAG	MSKVFRHDAITLHSEVNEEDFEKFMKEELVPYFSRKYKGPTRVSRADLKNQSLLKDTEDGRKYLWITEWNGESVRGSSFENARLIKIEETEAMLKKLKSFGKRSSEKVFNELVNVKVATN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.