Basic Information | |
---|---|
Taxon OID | 3300027618 Open in IMG/M |
Scaffold ID | Ga0208736_1000407 Open in IMG/M |
Source Dataset Name | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 12502 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (37.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctic Dry Valleys | |||||||
Coordinates | Lat. (o) | -78.0486 | Long. (o) | 163.8053 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051753 | Metagenome / Metatranscriptome | 143 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208736_10004071 | F051753 | N/A | GHPIAVAGSNQAQPTPDPLAFVGVTDSVTDNGDGEQLELTLGPLYLVVVDDRVSAPLSGRAERFYRSPAQTLEAARCLAALLLDRGDELAGDGPWRRPLPGGQRHVCIVRAPVGPID |
⦗Top⦘ |