Scaffold Ga0209970_1044095

Overview

Basic Information

• Taxon OID: 3300027614
• Scaffold ID: Ga0209970_1044095
• Source Dataset Name: Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 798
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location

• Location Name: Joint Genome Institute, California, USA
• Coordinates
  • Lat. (^o): 37.931388
  • Long. (^o): -122.021761

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021663	Metagenome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209970_10440951	F021663	N/A	RALGQALEKFSFSAFDLELRSGTYLVTGRAVSTENVRFSFAGFVRELLRGAAGRPTLTCTDSQVDLRFSPEEIERFDLRGRVRRQDGGKMPDPYSISQILRGAGSYLDHREVTNLVAISLKGKWVTVSYQTTEGRIEQAQQDLEYFYDYWVKMYLRRSNRAKLPQPSEPTVFVTWKGIQKAPGIFNVPG