Scaffold Ga0209637_1072377

Overview

Basic Information

• Taxon OID: 3300027584
• Scaffold ID: Ga0209637_1072377
• Source Dataset Name: Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1858
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Zanca-sant'andrea, Tuscany, Italy
• Coordinates
  • Lat. (^o): 42.8072
  • Long. (^o): 10.1411
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023237	Metagenome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209637_10723771	F023237	N/A	MLYFANVFLWPPYSPALVNGGSRKFYTWWILSVIREVITWIFSWSSLNYRVGQKVTKFGIFSDPACKLSALTPERGRI