Scaffold Ga0209831_1002200

Overview

Basic Information

• Taxon OID: 3300027554
• Scaffold ID: Ga0209831_1002200
• Source Dataset Name: Marine algal microbial communities from Maine, USA - Maine_Asex4_metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17171
• Total Scaffold Genes: 30
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 18 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location

• Location Name: Maine, USA
• Coordinates
  • Lat. (^o): 44.342
  • Long. (^o): -68.065
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098555	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209831_100220023	F098555	N/A	MERAVDKAVSKIDCTVAVHIGKKKECKVALKRKLRKVCKRRRNATRSMIYRKTGVYLDAGVPQATIQPLQVLRGSEDELASSSAAILDQGTRYQLVLDDSDARATCFVDLKATAASIIAELLCVDPGHITAGTRAAGADHIKSFIEKNKMPKLLRPDSANVLNAVVQRICDELKDIAASQFNRSADEEAE