NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209424_1083667

Scaffold Ga0209424_1083667


Overview

Basic Information
Taxon OID3300027539 Open in IMG/M
Scaffold IDGa0209424_1083667 Open in IMG/M
Source Dataset NameNasutitermes corniger midgut segment microbial community from laboratory colony in Florida, USA - Nc150M (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)930
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Namelaboratory colony in Florida, USA
CoordinatesLat. (o)26.0625Long. (o)-80.2332Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030596Metagenome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0209424_10836673F030596N/AYILYFYNFIQVIDTTVQNNDEISLHFKPMRLIFMNYSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.