Scaffold Ga0209384_1075182

Overview

Basic Information

• Taxon OID: 3300027522
• Scaffold ID: Ga0209384_1075182
• Source Dataset Name: Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 850
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: West Antarctic Peninsula
• Coordinates
  • Lat. (^o): -64.8156
  • Long. (^o): -64.0406

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069338	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209384_10751822	F069338	AGGAGG	MTNEKHLDQYLVTSSGTVEIRDMGIKHHFDDLPVGEDMPTTIEDAAKMAYGQCADDTSIRVLRLNYAELTFTDVTDEVAQFVVYNLLDLQCEDVSPPEWAESELQDFNELHLIQTGS