Scaffold Ga0208787_1054303

Overview

Basic Information

• Taxon OID: 3300027518
• Scaffold ID: Ga0208787_1054303
• Source Dataset Name: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1103
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 40.178
  • Long. (^o): -81.073

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090314	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208787_10543031	F090314	N/A	GSSRELTSPTLGREFLAGDLEDEKTLGVFRRSILRSVQFETRIGVSTRTLAYTRKAIGELLASRKFPAVAQVSYLEPRSKLQHLRLIGISRGFVFTDFLQNPAIPIAALGSIELGV