NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208338_1000086

Scaffold Ga0208338_1000086


Overview

Basic Information
Taxon OID3300027514 Open in IMG/M
Scaffold IDGa0208338_1000086 Open in IMG/M
Source Dataset NameForest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28524
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (73.08%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameBrowns Valley, California, USA
CoordinatesLat. (o)39.23550963Long. (o)-121.2836963Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007997Metagenome341Y
F011793Metagenome287Y

Sequences

Protein IDFamilyRBSSequence
Ga0208338_100008613F011793GGAGGMSNWRKIAKRSTVLCCVLLTVSIAARSQTRYPGPEARENNRSMDEYDRTLNRMKNDAKAATERRRSLFPQINEDFQRIQVIHNEIVRMLQPDKGLNYDRLADLTGDMKKRSARLRENLALPQPEKTDTPPTHSNAIDEARLKKSIANLHDVVVNFVANPLFKNLGVVDAKVVDAAGENLDEIIGISDEIKREAKSLSKTAKD
Ga0208338_100008615F007997N/AMRLRIERKHFSLRLALAVACVCVSALSTFASSAVVIRPEVSRSHREELIKRLRVITGWSSLSFDNNGSLRLGETQTSNGSESARLLLKQAIAGPNVIVLEDASSRTDVAFCRVVRARWLRDEQNKPPAFVVLIDFKDFQQLSGDAEARAAFDVGWGLLHELDHVVADSEDARDAKAVGECEDHINRMRLEVGLPVRVDYFFSRAYLKADSNFNARYVRLSFERETKRYWLVWDATTVGGLHDDSQRALVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.