NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208338_1000013

Scaffold Ga0208338_1000013


Overview

Basic Information
Taxon OID3300027514 Open in IMG/M
Scaffold IDGa0208338_1000013 Open in IMG/M
Source Dataset NameForest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)89390
Total Scaffold Genes90 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)63 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameBrowns Valley, California, USA
CoordinatesLat. (o)39.23550963Long. (o)-121.2836963Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002570Metagenome / Metatranscriptome547Y
F104023Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0208338_100001337F002570AGGAGMKTKLTLTLITLAGLIVFTGFVSGGNSSAAALAGRVNPHYKGASAFNPAGAGPNVARCGAFPENIELSFTGQGIDTEGGFNTAVFSACANLTTNTVFDLRATDTYPGSGDQVFIEADSFVQTIDPVNCTAVTAHAVPFRVAGGTGGHAGATGNGRFNLYSNLTPCNGQTPPAMVSFEGVIQIP
Ga0208338_100001339F104023GGAGMEFSGDEKKIQALFSELSLENQTRTPRFEKLWLRAEANTPTRPPLVTRFVLVAIAVIVVMSFIAVRSWFAAPDSQYSANIPSQIVPTTPQPRVQHSDLSAVSRDLVRPRRSARRQTERTAINQAAMLSNWQSPTNILLNSPTVSVLGSLPQLTQSAIALEQFLPKKNNELIKESKQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.