Basic Information | |
---|---|
Taxon OID | 3300027514 Open in IMG/M |
Scaffold ID | Ga0208338_1000013 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 89390 |
Total Scaffold Genes | 90 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 63 (70.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Browns Valley, California, USA | |||||||
Coordinates | Lat. (o) | 39.23550963 | Long. (o) | -121.2836963 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002570 | Metagenome / Metatranscriptome | 547 | Y |
F104023 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208338_100001337 | F002570 | AGGAG | MKTKLTLTLITLAGLIVFTGFVSGGNSSAAALAGRVNPHYKGASAFNPAGAGPNVARCGAFPENIELSFTGQGIDTEGGFNTAVFSACANLTTNTVFDLRATDTYPGSGDQVFIEADSFVQTIDPVNCTAVTAHAVPFRVAGGTGGHAGATGNGRFNLYSNLTPCNGQTPPAMVSFEGVIQIP |
Ga0208338_100001339 | F104023 | GGAG | MEFSGDEKKIQALFSELSLENQTRTPRFEKLWLRAEANTPTRPPLVTRFVLVAIAVIVVMSFIAVRSWFAAPDSQYSANIPSQIVPTTPQPRVQHSDLSAVSRDLVRPRRSARRQTERTAINQAAMLSNWQSPTNILLNSPTVSVLGSLPQLTQSAIALEQFLPKKNNELIKESKQ |
⦗Top⦘ |