Scaffold Ga0209537_1105858

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209537_1105858

Scaffold Ga0209537_1105858

Overview

Basic Information
Taxon OID	3300027510 Open in IMG/M
Scaffold ID	Ga0209537_1105858 Open in IMG/M
Source Dataset Name	Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	643
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location Name	Bielefeld, North Rhine-Westphalia, Germany
Coordinates	Lat. (^o)	52.0385	Long. (^o)	8.4956	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079954	Metagenome / Metatranscriptome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209537_11058581	F079954	N/A	MNKERWTKQKILKTCLELIPKINASTLNAFLIRVEKDGKYFSKMTFYKKIRPDSKEYKQIIEAIEDNNIYLGEYGLSKLKDLVDDHNLKAIEDWLRIYGSDKVKQALSRNYNITAKADISFEQEMKKVEEDL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.