Scaffold Ga0209904_1001822

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209904_1001822

Scaffold Ga0209904_1001822

Overview

Basic Information
Taxon OID	3300027394 Open in IMG/M
Scaffold ID	Ga0209904_1001822 Open in IMG/M
Source Dataset Name	Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1728
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location Name	Sweden: Kiruna
Coordinates	Lat. (^o)	68.3534	Long. (^o)	19.0472	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042777	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209904_10018222	F042777	AGGA	MKQAVGSYVVSFQAEPFHKGTRYHWMICWAQNPDELVSWGHAPTQELAEMAAQNEVKDLSSGRTQGGRVTNTSKSATH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.