Scaffold Ga0209904_1000912

Overview

Basic Information

• Taxon OID: 3300027394
• Scaffold ID: Ga0209904_1000912
• Source Dataset Name: Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2564
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location

• Location Name: Sweden: Kiruna
• Coordinates
  • Lat. (^o): 68.3534
  • Long. (^o): 19.0472
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042777	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209904_10009121	F042777	AGGA	MTQAVARYVVSFQAESFRKGRRHHWMICRAQNPDELVSWGHALTQELAETAARSEVNSLASGLTQGGRVTTIKLATHHV