Scaffold Ga0209904_1000809

Overview

Basic Information

• Taxon OID: 3300027394
• Scaffold ID: Ga0209904_1000809
• Source Dataset Name: Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2769
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location

• Location Name: Sweden: Kiruna
• Coordinates
  • Lat. (^o): 68.3534
  • Long. (^o): 19.0472
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069385	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209904_10008096	F069385	N/A	YTAIDTIQTAPRAKTMTFDPATKRLYLSTAEAGQFEVLVVGR