Scaffold Ga0208172_1000182

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208172_1000182

Scaffold Ga0208172_1000182

Overview

Basic Information
Taxon OID	3300027231 Open in IMG/M
Scaffold ID	Ga0208172_1000182 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22517
Total Scaffold Genes	31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (29.03%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location Name	Columbia River Estuary, USA
Coordinates	Lat. (^o)	46.1869	Long. (^o)	-123.8842	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051134	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208172_100018231	F051134	GGA	MKYTIVGCITKYGIEQIKPFVESIEQSGFNGEKLMLVYDISKETIEYLDSKGWLITQSEPQQHIILQRFRDMYALLQSYETDVIIWVDVKDIVFQKDPTEWLNTNMNKDILAFSESLKFGDEAWARLNAGTSFPMEWEWLQNEEIYCAGTIVGKKEAIRDLFIDIYRWSL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.