Scaffold Ga0209516_1030318

Overview

Basic Information

• Taxon OID: 3300027055
• Scaffold ID: Ga0209516_1030318
• Source Dataset Name: Groundwater microbial communities from S. Glens Falls, New York, USA - Naphthalene biodegradation metagenome 12C3dose (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 524
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CSP1-8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location

• Location Name: S. Glens Falls, New York, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -73.604444
  • Depth (m): 98

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026036	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209516_10303182	F026036	GAGG	MKFDSKRESPPTSDIGGIPALFFLVCAILFSVIAVPSAANAGLSLPEMSRLEASDAMSFDDTCSLFNGYLSFGLHSEAASLLERRVRLGVFPAKAAAPLFDEVVGAQGVDDSEGLVAVCETAIRSGIRTPLILYSYGTGLRRIKGRLGDASNILA