NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207800_1046522

Scaffold Ga0207800_1046522


Overview

Basic Information
Taxon OID3300027043 Open in IMG/M
Scaffold IDGa0207800_1046522 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NameLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003697Metagenome / Metatranscriptome473Y

Sequences

Protein IDFamilyRBSSequence
Ga0207800_10465222F003697GGAGGVTSSEASVPAGAAKAGGTASTRLFIRQTSGLVRELGIPAATAISLASVAVVNTFINFNAGLTDFTKSDMYL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.