Scaffold Ga0208448_101586

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208448_101586

Scaffold Ga0208448_101586

Overview

Basic Information
Taxon OID	3300026813 Open in IMG/M
Scaffold ID	Ga0208448_101586 Open in IMG/M
Source Dataset Name	Extremophilic microbial mat communities from Yellowstone National Park, USA - OSPB_Mat_virus_9_15 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1642
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	Yellowstone National Park, USA
Coordinates	Lat. (^o)	44.733	Long. (^o)	-110.709	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095753	Metagenome / Metatranscriptome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208448_1015862	F095753	AGG	MPSVNQSYAGMEAGVYFFKPAHDLQISAYAPLVKQGYKHYMAKDGKHIYILFLKVKKWK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.