Scaffold Ga0207480_104671

Overview

Basic Information

• Taxon OID: 3300026722
• Scaffold ID: Ga0207480_104671
• Source Dataset Name: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-A (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: Wisconsin, United States
• Coordinates
  • Lat. (^o): 43.43
  • Long. (^o): -89.41
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041230	Metagenome / Metatranscriptome	160	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207480_1046711	F041230	N/A	GTKMKTNLILQKVSFLHGLIDPSWIDGNPGQPGPIFRTAMTDYVVAELLRDISVNLHERDLATKVHNIGKELVSASSHALAAGWEDGDDICPPFKVGPRPHGDILPLTAAQPEPWLEHITPAMNDIVLAHAIRELASLTSSEKASNAIRQVGETIVKAAGSKLFEE