Scaffold Ga0208847_102321

Overview

Basic Information

• Taxon OID: 3300026673
• Scaffold ID: Ga0208847_102321
• Source Dataset Name: Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1116 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 547
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location

• Location Name: Nunn, Colorado, USA
• Coordinates
  • Lat. (^o): 40.81667
  • Long. (^o): -104.76667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044139	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208847_1023212	F044139	GGA	VGFNATRRYRDKKTVDIALLVAAIVIVLALLAWVFAAGGN